DPCstruct | MC30747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D1KU90 | 4-71 | LRTTGYPDIHDNEYAILEATGEISIFPRKELVPITPKDLHMKVEYRGLPIAVVIEGKVQKRKLKFINK |
| A0A521F633 | 1-78 | MNLNQLQSLLRQKNVFSIREVAYAILEADGTLTVLKKWNDSPPTRSDLKLTPQPVHLPVTLIIDGKIQRDNLSEIGWT |
| A0A645J7I8 | 2-71 | None |
| H6CJ00 | 10-89 | None |
| A0A2T0LD47 | 127-187 | None |
| A0A7C8LGN9 | 5-70 | None |
| A0A7C6VFY6 | 80-155 | None |
| A0A1I1P8K7 | 38-114 | None |
| A0A7V3SZ88 | 1-84 | None |
| A0A1Q6RBP6 | 107-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.