DPCstruct | MC30744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 168 ± 22 aa |
| Standard deviation of domain lengths | 21.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.06 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF10367- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5L255 | 13-165 | AEIVELQQRSIYVSSNQTCELCKRNILSTQFYVFPCGHAFHSECLLENIRPHLSVEQRSAVESLVKMIAAGGGGGGGDAKHGSAAVA… |
| A0A811WDZ4 | 140-295 | DDFREPICQSLQEYNNQIEELKAEMEEATKSAEYVRSEIQSFRNCSVLVSVTDSCSLCALALLLRPFYLFPCAHRFHADCLRAEIQP… |
| A0A7S1KLX7 | 2-170 | None |
| A0A7S4L7C0 | 301-525 | None |
| A0A7R9U7K7 | 197-372 | None |
| F4QB90 | 346-517 | None |
| A0A7S1PSD5 | 1-152 | None |
| D8LI29 | 699-870 | None |
| A0A5A8BZ13 | 216-435 | None |
| A0A131ZX45 | 129-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.