DPCstruct | MC30743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 200 ± 28 aa |
| Standard deviation of domain lengths | 28.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4Z3K6 | 7-206 | KIAIWMEFFIPTPTIEALGECFHGDGRDFSPDPNEQRFRARSDIVVTGFLAEQPGETDFHQCGESQKLDCATGEVLATETASTDAMS… |
| A0A7Y6P4G5 | 158-342 | NQMDIKYRTFIPTKYAPAASIFSGWIGGDKFGGDNRSFSFSGGSHRTQTEAVARFTSSGSSTYFRKDVNYTRLYDKDGNFKKQQKPT… |
| A0A6I6NFV3 | 212-402 | None |
| A0A0D0GI14 | 20-218 | None |
| A0A369T6R2 | 432-666 | None |
| A0A7Y6ES81 | 4-197 | None |
| A0A5E8PD16 | 129-312 | None |
| A0A536RHZ7 | 1-182 | None |
| A0A2S8BGL2 | 8-189 | None |
| A0A1Q3N2I5 | 469-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.