DPCstruct | MC30742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 171 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S9SYE4 | 1-168 | MLDIIIIILLLSGLFIGLKRGFIRQFIRLVTFIAAIAVAATYYGDLAPKLGWIPSPDFTGGQAALAFVNGSLEGAYYNMIAFLILFI… |
| A0A7X7N5G2 | 1-152 | MTGIDATIILLFLSGILSGTVRGFVSSIFDLLGIVIGIILASLIYKAPVVLFAKFNIIGDAVHIVFFLLATFILTFAAIVFLDIIRK… |
| A0A2A4QV86 | 61-255 | None |
| A0A1Y0FRY7 | 1-164 | None |
| A0A7C6C802 | 5-163 | None |
| A0A1X3KDR1 | 1-145 | None |
| A0A1I6E345 | 2-214 | None |
| A0A7G6E4Z2 | 62-300 | None |
| A0A2Z4FL41 | 4-188 | None |
| A0A523DPN4 | 163-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.