DPCstruct | MC30739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 10.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7NB13 | 2-112 | SEHFTRVEIVFYPEHLNHWLRFGAPDVQQDLDRRRSLALFKPGQVFGYIRWRANEYGTQEWRFTIVRAAEPSLLLSRIPGVCPGGEV… |
| A0A3N9VEY1 | 1-134 | MDFLTEVQLLYEEKSRNAKLLFGTPVRSEALHFSAGASKRNVYFKPDSLFALELWAANDYGTVFWMLYILRTVWPGERANRIPQITP… |
| A0A378A0G7 | 125-261 | None |
| A0A2G2FZU9 | 2-136 | None |
| A0A4R2PTK1 | 23-158 | None |
| A0A7V8RCG8 | 80-203 | None |
| A0A258SF01 | 118-253 | None |
| A0A2S9IR85 | 1-133 | None |
| A0A4P7JBP1 | 5-130 | None |
| A0A257J7C7 | 19-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.