DPCstruct | MC30734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 13.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844W5I2 | 1-93 | YKWLGRGDKNSADGAAVNAMRIMLNLVNIDGTIVIGEGEIDEAPMLYIGEKVGTGKGDAVDIAVDPIEGTRMTAMGQANALAVMAVG… |
| A0A5A7N6T9 | 7-117 | LDRQLVLEMVRVTEAAAIAAAQWRGLGREKEADQAAVETMRAAFNKLYIDGTVVIGEGERDDAPMLFIGEKVGLGGVAVDIALDPLE… |
| A0A3S4M6W7 | 48-155 | None |
| A0A5K7XLB1 | 32-140 | None |
| A0A378N7U6 | 4-93 | None |
| A0A5B8MRD8 | 483-597 | None |
| A0A6B2DBZ9 | 10-90 | None |
| A0A535SRW2 | 15-118 | None |
| A0A830HL11 | 221-330 | None |
| H1DA55 | 3-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.