DPCstruct | MC30733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 186 ± 30 aa |
| Standard deviation of domain lengths | 29.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354I9Y7 | 1-182 | MTAAVAASSVAVAPTPKKADAAGSYTAYLCFASKTYKGVCSNHDDGEFNLGVHNGNTKKKIKTSIKNATFKKGKVSFTVSVTGNALK… |
| A0A415GL44 | 85-230 | GVYTPTFNAVRGWGEGEAQLWGYNDGSTLKVVKSDKGQYSLENNQFDMTYEGSGFEGGTIMTFVEIADLYGFFPGTHSTLDEFYLDG… |
| A0A1V5GMA8 | 57-278 | None |
| R7KTN9 | 204-415 | None |
| A0A7C6HCQ0 | 43-280 | None |
| R5LIY4 | 2-151 | None |
| E6UGY1 | 1-160 | None |
| R5RLT4 | 1-201 | None |
| A0A3R6RM51 | 256-422 | None |
| A0A1H7NI08 | 570-752 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.