DPCstruct | MC30728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Standard deviation of domain lengths | 17.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00921 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218PFC5 | 63-182 | KSVVDTFITNTLDKIADGAKTAAKGATGDVIGNATATGHGATPASKDSVVSLVKGIKTIVEVVLKKDEGNAGATKTGDDKKDVGKLF… |
| W5SWE5 | 15-161 | MKDKGNPSAIAVETAVNNLVTEKLDKIIKGAKAVSDAIGVSVGSIDDVAHGGAAGVGIKADEASVKSVIEGICNIVDIVLQCKGDAE… |
| W5T266 | 2-125 | None |
| A0A482CYJ2 | 49-185 | None |
| W5SC34 | 19-176 | None |
| W5SB23 | 1-152 | None |
| A0A142JDL6 | 49-210 | None |
| W5SLV5 | 2-118 | None |
| W5SXX4 | 3-127 | None |
| W5SXN6 | 6-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.