DPCstruct | MC30721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0100 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9HGR5 | 30-139 | MPTSCTDLQRMGHKLSGFFSVKGSNKMEMIYCDFYPNENEIQTRIGYVDVKSAPVHFYVTRDTTFKLTNTPIPFDLVRMNEGNAMDL… |
| E9GPK3 | 1-111 | MPTSCEDIWSIGHTLSGIYSVKGVKIVENVNCNFENLPKEAVFQKWIGYDEVKVGACLLLRLAAFNTANVSIPFQVSKLNIGNAMDL… |
| E9GDI0 | 258-370 | None |
| E9GD79 | 373-478 | None |
| E9GCS6 | 580-674 | None |
| E9G7T7 | 40-132 | None |
| A0A164ZUS0 | 1-139 | None |
| E9I0P4 | 314-404 | None |
| E9HCI2 | 106-196 | None |
| E9GQQ6 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.