DPCstruct | MC30719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 389 ± 65 aa |
| Standard deviation of domain lengths | 65.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818Z605 | 30-323 | FQVEMGTKNIGRIKYQDGEVVIKQNQQKQTDFFFTPFPYLRPEETQCYENVFSDRVELGLQVELYTPQLIRAVKDYVYKYQSSLCGN… |
| E9GIW0 | 33-451 | NDKVPAPTSSGLESSWANLQLSPLAVKSMPYRDFRVKIYQHGGDSTIRKSHPHHQRYFFTPIALLDHRSAVSSHNNVTGEAELRFVI… |
| A0A817CRW5 | 6-381 | None |
| A0A1I8IG14 | 22-442 | None |
| E9GBF2 | 2-379 | None |
| E9GCS6 | 2-425 | None |
| A0A813SDY2 | 58-464 | None |
| A0A813YHX5 | 2-450 | None |
| A0A267E7U9 | 15-419 | None |
| A0A817M2E0 | 26-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.