DPCstruct | MC3071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 14.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6AMP0 | 3-128 | PPCEVMVKKFLPAVRALVAHALKEEGLEQEKIARMVGVTQAMVSYYLAKKKDGFITSLARFGLSEEEISSMVSELKGAAKASEVYAT… |
| A0A497HHY3 | 20-116 | VNMSLPCEFIAKYVIPSLRREIVRILSEEYEMSNRDIAKRLDLTDAAVSQYLSNKRGTGFELNETILAMVRRSAGRIARGKTSIDEE… |
| A0A0B3B0U5 | 15-132 | None |
| A0A257MEX6 | 66-168 | None |
| A0A2D6K6A4 | 17-133 | None |
| A0A0E3QML1 | 35-141 | None |
| A0A151DW11 | 3-94 | None |
| A0A2R6ARP8 | 4-112 | None |
| A0A0E3LN69 | 1-81 | None |
| A0A2P6VXS4 | 34-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.