DPCstruct | MC30709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 71.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831YGX0 | 47-112 | AKVLRRFPWMVEVIKQRPMGILHPYTVEVYVARDGSEACLSLNPPKAYCVQNGAVKEVKLDLEFSR |
| A0A831V0H8 | 210-273 | VMRRYPWMAEVLRRRPVANPHPYMVEAYVAGDGSEACLSLNQLRTYCARGGAVGEARLELEFSR |
| A0A831YDN4 | 48-103 | None |
| A0A832DT66 | 102-167 | None |
| A0A831YI29 | 1-63 | None |
| A0A831YCH9 | 160-221 | None |
| A0A0K1E3H2 | 48-116 | None |
| A0A0K1E3G4 | 18-77 | None |
| A0A101XFJ1 | 18-93 | None |
| A0A0K1E4E3 | 124-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.