DPCstruct | MC30705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 401 ± 87 aa |
| Standard deviation of domain lengths | 86.55 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4WHP2 | 104-368 | VEELHQRGEIDDKKKDELVKEIEAGPNVVEIAGVEISVAAREKAGSKGLSIAYHLRSANAFEDAVKALKEAGFEEGVHFTVKKPEKV… |
| A0A7C5T8S6 | 33-406 | RRTKNAVAADLHISALGQEVKFNLYLHKSEIMLRFNTTARKRAELAAGLLRALGVNAEARKKGESEWSVFASTDQLAAGHEKLRKTI… |
| A0A831YID4 | 509-907 | None |
| G7VHZ0 | 194-425 | None |
| A0A2J2HBV2 | 4-382 | None |
| H6Q925 | 691-1189 | None |
| A4WJ76 | 198-563 | None |
| A0A7C5X9N9 | 496-944 | None |
| H6QAQ4 | 1-280 | None |
| A0A7C5X9F2 | 220-613 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.