DPCstruct | MC30704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 86 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5IUP1 | 18-98 | MTSLNLSPRPVDLKGKRLGLLDNSKANSDIILNAIAEVLNQQYEFADIFYVQKHSACLPPVPEILADLHRNCDVVIAGVGD |
| A0A522MYQ2 | 24-112 | LVDPVDHSSTTLAAAQRLESLAGKRPGLLDNRKGNGDRLLERIGQLLVDRYGTLEPYRTTKFIYARRADEKILEDLAARCDFVVTAV… |
| A0A7S3PLP2 | 428-505 | None |
| A0A7S1VZK8 | 103-188 | None |
| A0A2V6SZG3 | 279-353 | None |
| A0A2D9JKG1 | 9-82 | None |
| A0A7S2ER47 | 325-394 | None |
| A0A6L8DY27 | 103-186 | None |
| A0A1F4DYF7 | 1-120 | None |
| A0A2E3TUU2 | 55-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.