DPCstruct | MC30702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 228 ± 31 aa |
| Standard deviation of domain lengths | 31.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 11.66 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0170- PF05238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060Y1W4 | 1-208 | MDDSTKHILQRLMRRIPSQMLQTMLGKWAHLSREDLHSLDFTQPKWVLTEHLLALCEENGLRVKHITELEMIYIIENPNQGMWHGFQ… |
| A0A3P5VP84 | 1-206 | MQTTPDDLAEALYYVNEMSTQEGFDSLQDAIADTDLDVVIGENAAHADLAIQVWMQDRDLVERIHAEQFLFRPRSFEYFKTDNGSVP… |
| A0A7X7G1Z2 | 1-210 | None |
| A0A3L8E471 | 10-199 | None |
| A0A2U2SGQ5 | 8-218 | None |
| A0A177ULJ5 | 317-500 | None |
| A0A5C5YEE0 | 117-342 | None |
| A0A0E3YUZ6 | 87-291 | None |
| A0A4R7U6X9 | 10-289 | None |
| A0A7R8HCT3 | 2-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.