DPCstruct | MC30701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 978 |
|---|---|
| Mean domain length (aa) | 167 ± 26 aa |
| Standard deviation of domain lengths | 25.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 98.24 |
| Assigned Pfam label(s) | PF07833- PF01510- CL0144- PF05036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1GT51 | 359-458 | QIEENYTSYFPKYGYRNGVGRPEGIVVHDTANDNSTIDGEINYMKNNYQSAFVHAFVDGNRIVETAPTDYLSWGAGPQGNERFINVE… |
| A0A3P5VHL9 | 24-196 | IRMKIEQHHLSINPYSRSGKLLHEVKTIVMHWVGNAGSSAETNRNFFESRKDGKQGYGSAHYIVGIDGEVIECIPTSEAAWHVGSKS… |
| A0A2P9I7K6 | 625-796 | None |
| A0A2E1VP77 | 416-581 | None |
| A0A543JYH8 | 21-186 | None |
| A0A370IAQ4 | 338-535 | None |
| A0A7C6S114 | 752-935 | None |
| A0A7R9PR67 | 48-198 | None |
| A0A0R4I979 | 67-220 | None |
| A0A7R9PS34 | 104-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.