DPCstruct | MC3070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A640W4M1 | 1-108 | MRVRVGSKLVLMFFVFTLVFVAFQLFAPVFLPPSTIGNLSGSVGIIDNSEKVRQIGLPWRIVYLVGDFMCHQRADRSFFINSNQMPF… |
| A0A7J4F359 | 5-112 | PFILFTLTFFYLLSNFLAPLLLEPGTVENLNGGANRVDYLEKWKNMASDGHVFEAFIYLFGDFNCHQKHIRSFEIHGNQMPICARDI… |
| A0A662MCU0 | 26-156 | None |
| A0A534K5U8 | 14-134 | None |
| A0A7C5FJ82 | 15-130 | None |
| A0A7C4DC79 | 1-130 | None |
| A0A7J4P9F2 | 252-359 | None |
| A0A534ME26 | 70-218 | None |
| A0A523YHX8 | 44-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.