DPCstruct | MC307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 218 ± 21 aa |
| Standard deviation of domain lengths | 20.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8TVB6 | 1-216 | MGYDITFHSISKNELKQFFFDIIIDPSCAEARSKSIPASEEKQKAMYEHLYKDNLVPWGELVRQGKGETMGDISPSFSMAAAAISGY… |
| A0A2U4FT13 | 3-210 | LGLDTAYIPVAEEDIKYFVEDVCNNPDLVEQRVNQLTPSEQERKFLTHTLYKNLLAQTENDPFDSHFGFTSCCILAYLSPYYYDRGQ… |
| A0A6J4U584 | 105-356 | None |
| A0A2S9XLD7 | 1-190 | None |
| A0A521U7K8 | 3-239 | None |
| A0A7X8W7L5 | 2-207 | None |
| A0A356KW76 | 6-250 | None |
| A0A5N0DTM3 | 1-196 | None |
| V4JIR6 | 1-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.