DPCstruct | MC30697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 83 ± 16 aa |
| Standard deviation of domain lengths | 16.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0T0L0 | 48-127 | GLTKPKGLDEACCNMRYNGPIFVAPLWREIYQMDSDRIQDWEEAKATHIAVCAAWKQYGYDFVELPKADVGERENFVRQR |
| B7WQE1 | 16-96 | ALDGTTILDTIAQSHRYHSRIFLAPPWPEIYVQDEERRHSMDEARAEFERLQRTYPALGYAVSRLPKIRVAQRADFVLDTL |
| A0A7C7TDZ4 | 31-105 | None |
| A0A0B4XF38 | 88-163 | None |
| A0A4D7J9W4 | 24-129 | None |
| A0A0F7PMH4 | 23-121 | None |
| A0A3S1I5A4 | 52-116 | None |
| A0A2W6S811 | 16-89 | None |
| D0XE48 | 6-73 | None |
| A0A2U1SM89 | 40-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.