DPCstruct | MC30693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 19.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150KFN9 | 1-166 | MQITVAEARLLKNAVSKKLHDLIQERNQIAYVEFEKGEKYTPHARTFQEVGTEIHQVRNHYRAVIKALAASNLRTTIEWKGEKVSIV… |
| U7L1T7 | 1-148 | MLLAEALAERAQAQERLNELRERLLSVVRVQEGDTPDEDPAELLRELEGITGRIDKLVQAINATNAATDFDGEKNLMQALALRDGLV… |
| A0A061A2C2 | 1-113 | None |
| A0A133QLV5 | 41-187 | None |
| A0A5R9DX35 | 3-162 | None |
| A0A2A6ZGA0 | 1-163 | None |
| A0A6F9ZHS5 | 2-118 | None |
| U2WA57 | 72-241 | None |
| A0A1E4SB73 | 1-177 | None |
| A0A0F9U4P9 | 57-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.