DPCstruct | MC3069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4D6S1 | 111-220 | EQLTLDFDEKSDYAKANLIDVLNDLSEKGINFKVYETHRGYHVRAKLPNSLSLEEILGMREKYKDDYARLRIDSHYLRHGFGFLTNL… |
| A0A497HA13 | 1-104 | MELRLDVDGKQKGSKRIKKVIELLGLKVRYWEIYKTNNGWHHYIGVDNKLTDLEVVLVQALMGSDFKRECFNYLRVKSGKFSYDDWN… |
| A0A662QDB6 | 1-119 | None |
| A0A497J4D4 | 3-111 | None |
| A0A662IP31 | 1-120 | None |
| A0A7C5SXU4 | 1-104 | None |
| A0A662QXK8 | 14-109 | None |
| A0A2R6C631 | 136-249 | None |
| A0A842RCQ8 | 8-117 | None |
| A0A0F9R1C4 | 25-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.