DPCstruct | MC30686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 8.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4EQL9 | 2-83 | TIIGMLHHRKDPNDVKKAYTYAAVAKAEGVDFFYFTLGKVNIETEKILGKTYENGKWVEQEFSFPDVIYNASVHISDKNQQI |
| F5LB47 | 1-101 | MFHSFPYDPPNQTTVAVFVKPSIIKALNNQRVKKRIDLLRQANQQVRTNLFFFAMPDVDLAHKQIKGTYYDDRYKIWKQKLFPFPNV… |
| A0A554A479 | 487-574 | None |
| A0A0F5HNL8 | 2-86 | None |
| S7SVT4 | 31-119 | None |
| V9GCG8 | 2-88 | None |
| A0A2N6RKB7 | 4-93 | None |
| A0A318R9T1 | 1-70 | None |
| A0A6B0Q3E5 | 3-94 | None |
| A0A5Q2N0P8 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.