DPCstruct | MC30685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 162 ± 34 aa |
| Standard deviation of domain lengths | 34.02 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F5L6M4 | 89-229 | ASFCGGTFSIVALMLVAPIMADVATAFGPSEYFALMLLGLTAIASLSEGSMTKALIAAVLGLMVSTIGIDGQTGTPRFTFGSFQLMD… |
| A0A6B3JXB5 | 67-295 | GGAWYGGAIPAILIRVPGTPVNVLTTYDGYPLAQKGHPMRALSLAYSSSFVGGIISILALIFLAPFMAKIAAKFGPPEFAAVMILAS… |
| A0A6L5DDP3 | 167-322 | None |
| A0A1Z2SKD8 | 63-326 | None |
| A0A090SPW5 | 2-142 | None |
| A0A812T3Q8 | 880-1071 | None |
| A0A4U0R884 | 4-189 | None |
| A0A395YH52 | 123-313 | None |
| A0A1X6YIQ5 | 23-171 | None |
| A0A4Y9VC92 | 841-978 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.