DPCstruct | MC30684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 118 ± 29 aa |
| Standard deviation of domain lengths | 28.87 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05389 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828CAJ5 | 1-93 | MFVVEFSTFEDFVQLAHVLRIEGGVSNLYSYQEKYYLELVLFDDNYSEESAKDLISLSFEYGKNSKISPILLKERGKLVMGQTALEL… |
| F5L679 | 17-122 | NQQTETVSHKPYYSCVYKFRDIEDVINLAHRLPLPFFNSKLIRYHHFYYLSVMYPQERMIRRYDWGESIILEYGERTNESIYRLEEY… |
| A0A7C6FQK3 | 1-162 | None |
| A0A1F8U5Q4 | 48-165 | None |
| K0ZVK4 | 20-133 | None |
| G6EQD3 | 42-153 | None |
| A0A3C1J3G7 | 16-124 | None |
| A0A357ASF9 | 281-394 | None |
| A0A1I1ZNT3 | 89-183 | None |
| A0A3N1XC46 | 28-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.