DPCstruct | MC30677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6CNF8 | 840-892 | TKEYTVRAIVAETTTHYLIKWEDDAATGESYDDTWEPMGNANAAAVADWEAGK |
| A0A0D0C594 | 7-66 | EETQFIPQSGDEDTLWEAVAIVAENAKLYKIKWAGFDPATGKPWADSWVAKHDVTRDLVE |
| A0A0W4ZWD5 | 5-75 | None |
| A0A6A6WLG2 | 174-239 | None |
| E3JTN4 | 1-60 | None |
| A0A6A4H4B7 | 13-71 | None |
| E3JTM2 | 1-60 | None |
| A0A3M7LZY1 | 31-92 | None |
| A0A0G2EU70 | 5-61 | None |
| A0A2G5GKR1 | 141-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.