DPCstruct | MC30676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 218 ± 16 aa |
| Standard deviation of domain lengths | 16.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2D870 | 3-204 | FGDTVSPSLPQGPLDDVTSEDSQLTAYAEMVDASVAVFQHIGDGVFVVQGWDARRKQLTTSWFHLQCLQLENDVGVACTCPNGIQEG… |
| A0A0D0C4W7 | 1-247 | MLWLMQVQREDFYNNTALVSLDSPNVQYTFPSTNKIHEDFAYYLESVLSGCVGFIRLHGTMFAVEGWSDHTGEGTDRWYHFEASVLR… |
| A0A4Y7TW72 | 99-334 | None |
| Q5KN53 | 216-436 | None |
| A0A177UMP0 | 91-339 | None |
| A0A4Q2D407 | 51-273 | None |
| A0A0C9SPP6 | 115-324 | None |
| A0A0D0CFX3 | 1-198 | None |
| A0A5C2RP06 | 42-251 | None |
| A0A067SFY1 | 294-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.