DPCstruct | MC30674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 11.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1T855 | 15-143 | QKGWRRTGAINVIVAYVCAIILFVFFSISVSQSSLSRPTIIFEGNCTSSARLNFFFHLLINILSGVVLASSNFFMQVLTSPSREEID… |
| A0A0D0C0K2 | 3-130 | TGWRFGAWLATTQAVAVLFLNIVILIWSSISAGWSSSGSVFQGDCDTVGHVSIGIHLVINILSTLLLGASNYVMQSLCAPTRSEVDK… |
| A0A1L9T8N7 | 55-201 | None |
| A0A1J9R7G3 | 405-541 | None |
| A0A2T6ZRD9 | 42-169 | None |
| A0A420MJD2 | 1-146 | None |
| A0A6A5ZXZ0 | 28-168 | None |
| A0A2J6TLL9 | 73-209 | None |
| A0A177DGR0 | 16-165 | None |
| L2G008 | 10-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.