DPCstruct | MC30672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 268 ± 67 aa |
| Standard deviation of domain lengths | 66.87 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 76.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2D3S0 | 1-147 | MLEHLNRVNDVYEKLNIECSALATLFRETFGAVAILNKKAVPAPYRNLFRQIAAEESILQMINGSSLDDLGHFLSNPCRAQVTKLVT… |
| A0A409Y9D3 | 10-173 | LTSFDPSITDPQDPAFERNKALVARMDKIPKLILDLSTVNLSLSRVFDRHFGLQAVLKGYQAPEVYRKFFIQLAANENALQLVPHRA… |
| E2LVW6 | 268-521 | None |
| E2LPP3 | 1-253 | None |
| A0A0C9V6Y7 | 1-213 | None |
| A0A0C3B5L5 | 1-284 | None |
| A0A4Y7TW72 | 525-779 | None |
| Q5KN53 | 545-962 | None |
| A0A177UMP0 | 375-660 | None |
| A0A067P9Q7 | 536-777 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.