DPCstruct | MC30671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177V7J0 | 291-374 | PTGERLEMLMLEYWEKLDTYADRKKRGALTPGESPPKKVNYIIITDGRPTDEPSDVIVNCARRLDEGRYPLAQIGIQFLQVGND |
| A0A0D0BAV2 | 7-80 | LDALLREYLDEIKSAKAHSPEKLRKIKHANFIVIMDGVPTDEPKEAIVDASRRLRDGKFPLVQVGIQFVQIGQS |
| C1H3J8 | 1-89 | None |
| A0A074RZH4 | 341-420 | None |
| H1VE36 | 159-224 | None |
| A0A2H3E3H4 | 44-119 | None |
| A0A167NX00 | 68-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.