DPCstruct | MC30670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 376 ± 62 aa |
| Standard deviation of domain lengths | 61.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 76.72 |
| Assigned Pfam label(s) | PF04062- CL0020- CL0175- PF14740- PF14737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0AX41 | 7-367 | FSLQTYFYPIGNTTPVNLIQDIAPEESANILLLGCGDPRNIFFTLHSNTFGEKSSRTRSFVDSEPAVLARNILLFTLIIDNEPSKED… |
| R7V1X0 | 8-262 | FVLESSLELYARHLLFLHIALEPKCRMGLQDKTELFLELFGNGLVRLQSMEYVRNLATEFIKMITDLDYLEKQMPFVDVSVLKFKER… |
| C4JQL0 | 21-427 | None |
| A0A2A9NIK5 | 14-391 | None |
| A0A6G0X2Q2 | 102-435 | None |
| A0A0S7E589 | 59-511 | None |
| A0A0G4H3E4 | 14-419 | None |
| A0A0M9VVA5 | 2-374 | None |
| K5W9D3 | 5-392 | None |
| A0A0C3BH64 | 742-1119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.