DPCstruct | MC3067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Standard deviation of domain lengths | 13.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7LVJ1 | 214-273 | AQYSSVGGYTIGYYTSGGDMLCAECAEDPENDAEYVDVYYEGPTEFCAGCNKEIESAYGD |
| A0A497GVP7 | 16-87 | RKYCTLGGYPIFYVSDNGNAICPDCVQEDQDLDKEEQELCITGHVVNWEDASLFCDQCNKRIESAYAEDEAT |
| A0A1X7AEQ5 | 40-127 | None |
| A0A1T1AP76 | 23-120 | None |
| A0A5C8AV54 | 139-197 | None |
| A0A497BK08 | 46-121 | None |
| A0A3N5W1R6 | 103-194 | None |
| A0A533J0F0 | 6-95 | None |
| A0A7I7SB52 | 41-106 | None |
| A0A7T1HXR4 | 6-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.