DPCstruct | MC30667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11756 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7D319 | 14-114 | LSDELATEFKTVQAMVAIYCRDHHQSGGLCESCQALLDYAEMRLDRCPYGQTKPTCNKCPIHCYKPDPKSQMQVVMRYAGPRMLLPH… |
| A0A550H530 | 6-109 | PRITREKKTIDKMVHIYCKAHHDFKGNKLCSECTEFREYAFLRLDRCPFQEEKSTCGKCLVHCYQPQMREKAKTIMRYSGPRMLLHS… |
| A0A7V2LL52 | 3-86 | None |
| A0A3N0IJ53 | 89-215 | None |
| A0A2Z6IDP0 | 30-137 | None |
| A0A2P1G4I3 | 19-159 | None |
| A0A1I5HA16 | 3-98 | None |
| A0A0F2SMI1 | 2-91 | None |
| A0A316NXW4 | 57-165 | None |
| A0A0B8PAR4 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.