DPCstruct | MC30666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 110 ± 19 aa |
| Standard deviation of domain lengths | 19.11 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09868 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B9D818 | 17-115 | EFDAKDFKKSLPHLSSELMGGEKTINIQGIQNIVPDPGAIDFIRRCSTKEEAFEIIEFLLNRNEISLDEFQSLKDQIKNQGLSSFGP… |
| A0A550H0Y4 | 1-100 | MFPNLSDELEGGESKVSIDAPRTDPETAENTMPDKFHNYDPNVVDFIRRCDTDEQAKTIIAYLQERGEVSKEYAEELKRQLKKEGVR… |
| A0A1Q6DV41 | 4-119 | None |
| A0A523VR88 | 16-128 | None |
| A0A7C2MTK4 | 3-105 | None |
| A0A5C9ECB5 | 15-111 | None |
| A0A1F5CUP5 | 2-96 | None |
| O59250 | 78-190 | None |
| A0A7C3U0N7 | 1-62 | None |
| N0BA76 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.