DPCstruct | MC30663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 146 ± 27 aa |
| Standard deviation of domain lengths | 27.49 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6M1Y2 | 24-146 | HVNAFKGYSNFEWKKAEQPDRARQVLNRGLDVCKANGWDEDRAALLEHWLQLERENGDQQSIQRVFRLLPKKIKKRKTQKNANGVEE… |
| A6R158 | 2-82 | KEERVALLNAWKSFEQTHGSPDDIAKIEKQMPSKVKKRRKLDDDRYEEYMDYMFPADDESSAKLSQILQRAHQWKKEQASS |
| A0A426X800 | 21-191 | None |
| A0A314L2Z6 | 535-687 | None |
| A0A2H1BZA8 | 135-305 | None |
| A0A2P5EAC3 | 13-123 | None |
| A0A6S7KAH2 | 48-193 | None |
| R1F8A4 | 90-253 | None |
| A0A086LXW3 | 40-185 | None |
| A0A2D4IWI1 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.