DPCstruct | MC30662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4I8Y9 | 142-246 | ATSDEIDQLEMVTNDQRRKMKRFLRLFNHGLWPPVREDEYLERFKGKKMEREGLPWTEEETERLRALCEFYDVSFGDPFLYISWEMQ… |
| U6LZG5 | 29-157 | GAADWMAIEGLTNAQRRLIIRHIRISFSALRLFNHGLWPENSYDDYMQRFQAPPLKREGMPWTEEEDKQLLELAEKYDVNFGDPWLY… |
| A0A7J6QAY4 | 128-247 | None |
| C5L0N6 | 907-1018 | None |
| F0VBS8 | 135-236 | None |
| A0A1X1BP31 | 109-214 | None |
| A0A7S2MF92 | 57-191 | None |
| U6LEV8 | 5-128 | None |
| S8F351 | 414-521 | None |
| A0A0G4ETI7 | 119-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.