DPCstruct | MC30661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821WKM9 | 10-155 | IEKILEPFRAAVKVQGDLVKQMKDSNVNKEDADFKQALNELKIRKKALEDQITKCMPKEESIDRLKMEDLLKRRFFYDQSFSIYGGV… |
| U6LWN0 | 31-180 | LQQQLQQQQGEVARLQEEARQLRKQQGSNSAAIAAATASLTAARDRVQQLEQQLQQQQQLQQQQQQEEEDDLPHFLKYKQQFENIIK… |
| A0A6Q8PH49 | 60-198 | None |
| A0A1J3K1Z6 | 2-126 | None |
| U6L8U7 | 107-275 | None |
| A0A2U1N8Y8 | 1-147 | None |
| U6JVK5 | 52-208 | None |
| A0A087HRF7 | 3-104 | None |
| D7FJG6 | 486-636 | None |
| A0A5N5SQE1 | 5-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.