DPCstruct | MC30660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2RR98 | 1-119 | PLYDLMYRAGVPLRNMRVCEPFGPEQRKGLWLYHVLEPETWARMCERVSGAASGALYANQSGAYFALRKRISKPAHHAWRSYAMFLL… |
| A0A376LJQ2 | 66-177 | PLYNIMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSGGIYAGHDNHFYGHRKILKPEHLDWQEYALLLLN… |
| A0A2A5SSX5 | 1-95 | None |
| A0A0A8RMJ6 | 121-230 | None |
| A0A2P7PDV2 | 40-137 | None |
| A0A485CJQ8 | 117-233 | None |
| A0A2A4H8Z7 | 1-99 | None |
| A0A336Q1Y7 | 1-92 | None |
| A0A485HQ16 | 121-230 | None |
| A0A376KYL3 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.