DPCstruct | MC3066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O28415 | 3-92 | FAVIDRKNFTLIHFEIEKPIKPEILKEIEIPSVDTRKGVVISGRGPIWLHCFLAHKYHHTPFVAVYDPRLGAVVVQSHSELREGDVI… |
| A0A497GVE3 | 3-107 | IYAAEWNSRHIVAVHVGDYIRYAELREIASRLEEYDEVLAKADVVILSGKMPSWYSLGLLATILKKYQPSVIGIYRPPADKVLVVYS… |
| A0A3B9HJV3 | 2-97 | None |
| A0A497F4N6 | 23-127 | None |
| A0A2G6JF86 | 715-826 | None |
| F5UN73 | 4-106 | None |
| A0A2H0PIS2 | 272-363 | None |
| A0A7C2Y262 | 146-257 | None |
| A0A3M1E511 | 3-80 | None |
| A0A1G1LPA9 | 217-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.