DPCstruct | MC30657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 65 ± 11 aa |
| Standard deviation of domain lengths | 10.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1LDH4 | 13-77 | LSFEVVTAGNRHVFDCFECAIHKLAPVCSHCGCKIIGHGIEAKETFFCCANCARQSGVSGVEDHI |
| A0A0J7Z6R0 | 2-63 | TFEVHAQGAVHVFDCFSCAIHRMAPVCEHCRVQIIGQGVEVEGQWYCGAHCARAEGKVGIVD |
| A0A7X0IC55 | 2-55 | None |
| A0A4R7I4Y0 | 1-53 | None |
| A0A840QI23 | 53-130 | None |
| V9XIR6 | 1-41 | None |
| C5TAT4 | 3-82 | None |
| A0A1A0MAT7 | 14-76 | None |
| A0A1F3SQF1 | 14-79 | None |
| A0A520PKL6 | 12-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.