DPCstruct | MC30655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 5.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G3A812 | 252-350 | RGKEGVDIIKIQGPSPWYVRPQNIDVLQPGDLLFFKMDHRTGNHMDHSAIYLGPDTEGHKVFISSRKEQNGPTIGDQGGVSRLDGNG… |
| A0A0J7Z1S5 | 1-96 | MAHGRLGVPVIPLTDRRPAVIQQLHPGDLVFFRTRELPGKRIGHIGVYLGLDTADHPRFISSRKNAGGPTMGDKGGTSRLDGDGYYA… |
| A0A7K2ZW71 | 35-127 | None |
| A0A1F7IG17 | 307-396 | None |
| A0A2P2FUQ6 | 1-83 | None |
| B5HZM3 | 115-206 | None |
| A0A838WCA6 | 78-171 | None |
| A0A4R4ZWW6 | 214-294 | None |
| A0A1C3N345 | 262-351 | None |
| A0A1H9EU85 | 140-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.