DPCstruct | MC30652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 2.56 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660VPR0 | 9-58 | RQVRCLNCFERIEVPAGVQRYRCPHCGYLWRISWHPSGMAKIRGPVWEEF |
| A0A3M1ZAP7 | 8-62 | KRKAQIRCLNCFTRFFPEPGQKVARCPGCEMEWRLTWTGPHAVKVRGPVWDKVPV |
| A0A2D6ESG2 | 77-126 | None |
| A0A0A7GFW8 | 1-49 | None |
| A0A523VJ74 | 20-70 | None |
| A0A662JA86 | 19-74 | None |
| A0A662ITS9 | 92-140 | None |
| A0A7C3AIS3 | 13-65 | None |
| A0A847EGP2 | 15-66 | None |
| A0A532U6N8 | 26-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.