DPCstruct | MC30651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 641 ± 59 aa |
| Standard deviation of domain lengths | 59.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1VQM6 | 107-815 | VQQILVRTVKEAKEESLADYLLDPQKKITGPELLRKLEEFVAPPAGTSKDSWNPEEQLSPADMEAVKVQLTRLLLTEDSKLIRIASK… |
| A0A843IRX6 | 29-671 | LWEFEDVIRRMPLRTFTSLTENNYLSKWLYARGLFGIGRVLKPIRSEDFVDEEEHRRMVLRAIHDFRIQQALGVVAAFNPESYNDAI… |
| H9UL02 | 206-858 | None |
| A0A7X8QVR3 | 101-721 | None |
| A0A8B5WWQ2 | 232-914 | None |
| A0A3M2G1B6 | 445-1116 | None |
| A0A5E4LK04 | 39-597 | None |
| A0A2H0DQ44 | 307-948 | None |
| A0A7C5H934 | 3-575 | None |
| A0A842ZQA6 | 318-1022 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.