DPCstruct | MC3065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 464 |
|---|---|
| Mean domain length (aa) | 176 ± 33 aa |
| Standard deviation of domain lengths | 33.12 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 99.39 |
| Assigned Pfam label(s) | PF02365- CL0028- CL0016- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2HRW7 | 4-114 | SSQSTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRDRKYPNGVRPNRAAVSGYW… |
| A0A7L8XV57 | 9-196 | RWPPGFRFSPTDEELVLFFLKRRVAAGRPSPYIADVDVYKSHPSHLPERSALRTGDKQWFFCSRLDRKYPNGSRASRTTADGYWKAT… |
| A0A6A6LI54 | 2-122 | None |
| A0A164XUS0 | 2-156 | None |
| A0A166DN27 | 43-242 | None |
| A0A0K9QKB8 | 19-259 | None |
| A0A803QMD2 | 6-144 | None |
| A0A2N9ILG4 | 104-248 | None |
| A0A6I9S8N3 | 7-199 | None |
| A0A803Q863 | 18-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.