DPCstruct | MC30647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 160 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832MWB8 | 1-173 | MVKKENLEKIQGILESTTRKWWFLVLFILIGTVTPPIVRKGFDPSKTGEIISYILRNAFIKFCSPLYPVFKIIPIILILALILFGNR… |
| A0A7L9FGK2 | 12-159 | LFILIILFLPPITSGKGIVWGVETGEVIRRVLSTTGGKYTAIAIGAHVLAITLIILLIGYGNRFRCLFNAFVAGDYILIAFLQNIAT… |
| A0A0P6XUE9 | 12-169 | None |
| A0A3D5B7B6 | 1-170 | None |
| S5Z766 | 2-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.