DPCstruct | MC30644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 290 |
|---|---|
| Mean domain length (aa) | 171 ± 29 aa |
| Standard deviation of domain lengths | 29.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 11.90 |
| Pfam Score | 27.37 |
| Assigned Pfam label(s) | PF11209- CL0648- PF09911- PF14356- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A5THI5 | 172-342 | IGCLSVLIILLLILGGAWIFIIRPYAHNMAETQLDRALGSVVNQLPTQLIDLLPAGATVPISENTINNLIVGNLAPSNPVQNPDTTI… |
| A0A1F8RJJ2 | 36-184 | VASQVTFVEQAWREAIAQSAGGEVIVIFTQEQLTEFLNLRISSQPQSRLKSVRVILDQATISVYGMLEAADLSASALVVLRPLISDA… |
| A0A1F6VKQ1 | 24-237 | None |
| A0A2H5ZYF6 | 14-141 | None |
| A0A1C6L9H1 | 4-161 | None |
| A0A1F6UQT7 | 210-385 | None |
| A0A832HDK6 | 14-176 | None |
| A0A1F8LEY8 | 502-669 | None |
| A0A2N3WBZ2 | 260-402 | None |
| A0A1R3W3S8 | 166-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.