DPCstruct | MC30643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 91 ± 19 aa |
| Standard deviation of domain lengths | 18.66 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.65 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0714- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X7Z3A2 | 133-216 | IAVPTGIKFFNWVGTMWKGQLTFETPMLFAIGFAVTFLLGGLTGVLLASPPLDFHVTDTYFVVAHFHYVLFGTIVFSTFAGCIS |
| A0A1B4Z252 | 15-85 | ATLHGTQINYSPSMLWALRFIFLFTVGGLTGVILANSSIDIILHDTYYVVAHFHYVLSMGAVFAIMAGFVH |
| A0A2A9M673 | 267-365 | None |
| A0A2A9M4R8 | 37-134 | None |
| A0A7E4S865 | 168-232 | None |
| A0A140CUS8 | 289-387 | None |
| A0A0N5CSU5 | 230-282 | None |
| A0A2G2WLJ4 | 25-122 | None |
| A0A2E5G7Q8 | 342-438 | None |
| A0A5S9MJG2 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.