DPCstruct | MC30641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 291 ± 39 aa |
| Standard deviation of domain lengths | 38.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2B5M6 | 2-291 | LSNADKADAFIISATMLCYGGLVSSRTPEKHLYQALKNLKSIEELKRRNPDKPVFVYDIIQRLAVTASSEKDLEYYKLVRQWAILDE… |
| A0A4R5TZE6 | 2-294 | SIALIPLDERPVCMQLPASVARIAGLDCALPPAKALPSIRQPGDPGVLAGWLSDRMGTSGHVVVSLEGLGFGGLIPSRIGSESVSDV… |
| A0A0C7L5R5 | 6-329 | None |
| A0A1Y0GZM4 | 21-227 | None |
| A0A1W1V4F6 | 31-318 | None |
| A0A7V9P857 | 35-374 | None |
| A0A7X8U979 | 67-389 | None |
| A0A1J5NK05 | 16-343 | None |
| A0A366XR54 | 197-520 | None |
| A0A537LK31 | 4-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.