DPCstruct | MC30640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 9.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5TWR7 | 31-134 | LPVDAHPKPLTWSDGTVVRNRVQSYDATFGRQATDPLSLHREQATGMTTLTAPSQPGITVFNDTNPNAYYDPANPQGSVIVAGTGTR… |
| C2MG74 | 535-656 | ADDSFKDNWVGVHPGEGFLGVVDSHPEALVGNLNGKPTYGNTGMQIADAAFSFDQTPAWSVNSLTRGQFNYSGLQGVTTFDDSKVYS… |
| A0A5C4VFG6 | 588-705 | None |
| A0A1C4U0I6 | 2-97 | None |
| A0A852TM64 | 138-243 | None |
| A0A7W1GR53 | 186-300 | None |
| A0A7V3PAA4 | 139-255 | None |
| A0A4U0SV63 | 315-415 | None |
| A0A1W6WQA9 | 12-114 | None |
| A0A523CA14 | 35-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.