DPCstruct | MC3064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 369 |
|---|---|
| Mean domain length (aa) | 200 ± 36 aa |
| Standard deviation of domain lengths | 36.40 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.85 |
| Pfam Score | 99.50 |
| Assigned Pfam label(s) | CL0062- CL0065- PF18199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A132NR08 | 11-159 | RMSEAVAKYLSTLVKDKRIQDKLAKFFVVIFRRLKVDPHVVAYALCLLTRIQYNKTNSLSSQNVKRYFFTAMLLAYNMLTDTPYDLP… |
| A0A7H4LNE2 | 12-213 | SSPPTPPPPELSMVARAVERLVARNDALLLLDAEQGGGEGITGMAAFEGTGPPRIGVAQYLERVHRYAALEPECYVVAYAYVDRAAH… |
| A0A086JC47 | 19-242 | None |
| I1CQD6 | 10-164 | None |
| A0A1D1YH83 | 294-490 | None |
| A0A0G4HGF7 | 244-504 | None |
| A0A4S2MN25 | 136-372 | None |
| A0A066WLS5 | 341-511 | None |
| A0A1S8VXZ0 | 253-465 | None |
| A0A1S8VUC4 | 319-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.