DPCstruct | MC30637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3V1K5 | 47-157 | IGNKLIKLYDLKFPKKCNTCGRVYQTRNEYLKATNPIKGRTGTVFAKNSVQEYRNCICGSTLIVITEERRDTSSFGNARRALFDLCL… |
| A0A369WQV5 | 7-129 | ATLSEVFEGLTALSNGAFPKQCGSCGKSYADLEQLVAETSTSEDGSGLKQVGSFSPQVEVERICSCGQLLTETFGDRRSSGEVGAQR… |
| A0A146GFC4 | 707-821 | None |
| A0A4Q6DRG9 | 44-159 | None |
| A0A1E2UUR8 | 1-129 | None |
| A0A7I8E5Q5 | 21-124 | None |
| A0A4Q6FVH6 | 39-151 | None |
| A0A2A4MR32 | 136-261 | None |
| A0A1J5SZ94 | 117-241 | None |
| A0A2E8I540 | 25-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.